PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang09g01100.1
Common NameLR48_Vigan04g056000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 320aa    MW: 36038.1 Da    PI: 6.9906
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang09g01100.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.61.6e-091359147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W  eEd + +    ++G+g+W++++r+  ++R++k+c++rw + 
   Vang09g01100.1 13 RGVWAXEEDTKKLAFGSKHGSGNWTSVPRKTRLKRCGKSCRLRWSNC 59
                     7999999999999999****************9***********986 PP

2Myb_DNA-binding42.51.5e-1367109246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++Tt+E++l++++++  G++ W+ Ia+ ++ gRt++++k +w++
   Vang09g01100.1  67 DNFTTQEEDLIIKLHAAIGSR-WSIIAQQLP-GRTDNDVKIYWNT 109
                      68*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.85860IPR017930Myb domain
SuperFamilySSF466891.71E-2210107IPR009057Homeodomain-like
SMARTSM007170.00131262IPR001005SANT/Myb domain
PfamPF002491.6E-71359IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-151567IPR009057Homeodomain-like
CDDcd001676.85E-41658No hitNo description
PROSITE profilePS5129419.95761115IPR017930Myb domain
SMARTSM007173.1E-1265113IPR001005SANT/Myb domain
CDDcd001674.67E-868111No hitNo description
PfamPF002495.2E-1268109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-2168115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MVRSPCEKVN VKRGVWAXEE DTKKLAFGSK HGSGNWTSVP RKTRLKRCGK SCRLRWSNCL  60
RNDLKHDNFT TQEEDLIIKL HAAIGSRWSI IAQQLPGRTD NDVKIYWNTK LKKKLSEMGI  120
DPVTHKPFSK LIADYGNIGG CQKPSTRIGS INKDFKSAMM LNSEPHQTMP QGSTNINDQE  180
TTRNNFIFNR AHGDNLSMDF ENEMISGSVL GEDRLSKTSS PSTPSTCSTS AFSWNDFLLL  240
EDDFTPLDYQ ETDTLVSKEN VVTIQSWNSK EVKSQHASGS SDFQFSSCSH TSFIEAMLDQ  300
ENEMFLSFPH LMEEPSNLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-21131157108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007138144.11e-175hypothetical protein PHAVU_009G183800g
TrEMBLA0A0L9UCS80.0A0A0L9UCS8_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RG070.0A0A0S3RG07_PHAAN; Uncharacterized protein
STRINGGLYMA06G20020.21e-150(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.14e-61MYB family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]